SCOPe 2.06: Domain d1iufa2: 1iuf A:76-141

Lineage for d1iufa2 (1iuf A:76-141)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.7: Centromere-binding [46756] (2 proteins)
   duplication: tandem repeat of two similar domains

6. Protein Ars-binding protein 1, ABP1 [74670] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [74671] (1 PDB entry)

8. Domain d1iufa2: 1iuf A:76-141 [71440]
   Other proteins in same PDB: d1iufa3
   low resolution solution structure

Details for d1iufa2

PDB Entry: 1iuf

PDB Description: low resolution solution structure of the two dna-binding domains in schizosaccharomyces pombe abp1 protein

PDB Compounds: (A:) centromere abp1 protein

SCOPe Domain Sequences for d1iufa2:

Sequence; same for both SEQRES and ATOM records:

>d1iufa2 a.4.1.7 (A:76-141) Ars-binding protein 1, ABP1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ppkyplleaalfewqvqqgddatlsgetikraaailwhkipeyqdqpvpnfsngwlegfr
krhilh

Timeline for d1iufa2:

• d1iufa2 first appeared in SCOP 1.61
  
• d1iufa2 appears in SCOPe 2.05
  
• d1iufa2 appears in SCOPe 2.07
  
• d1iufa2 appears in the current release, SCOPe 2.08