Lineage for d1iu4b_ (1iu4 B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188207Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 188208Superfamily d.3.1: Cysteine proteinases [54001] (8 families) (S)
  5. 188428Family d.3.1.8: Microbial transglutaminase [75336] (1 protein)
  6. 188429Protein Microbial transglutaminase [75337] (1 species)
  7. 188430Species Streptoverticillium mobaraense [TaxId:35621] [75338] (1 PDB entry)
  8. 188432Domain d1iu4b_: 1iu4 B: [71431]

Details for d1iu4b_

PDB Entry: 1iu4 (more details), 2.4 Å

PDB Description: Crystal Structure Analysis of the Microbial Transglutaminase

SCOP Domain Sequences for d1iu4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iu4b_ d.3.1.8 (B:) Microbial transglutaminase {Streptoverticillium mobaraense}
dsddrvtppaepldrmpdpyrpsygraetvvnnyirkwqqvyshrdgrkqqmteeqrewl
sygcvgvtwvnsgqyptnrlafasfdedrfknelkngrprsgetraefegrvakesfdee
kgfqrarevasvmnralenahdesayldnlkkelangndalrnedarspfysalrntpsf
kernggnhdpsrmkaviyskhfwsgqdrsssadkrkygdpdafrpapgtglvdmsrdrni
prsptspgegfvnfdygwfgaqteadadktvwthgnhyhapngslgamhvyeskfrnwse
gysdfdrgayvitfipkswntapdkvkqgwp

SCOP Domain Coordinates for d1iu4b_:

Click to download the PDB-style file with coordinates for d1iu4b_.
(The format of our PDB-style files is described here.)

Timeline for d1iu4b_: