SCOP 1.73: Domain d1iu1b_: 1iu1 B:

Lineage for d1iu1b_ (1iu1 B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
   consist of a single subdomain

6. Protein Gamma1-adaptin domain [74858] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74859] (5 PDB entries)

8. Domain d1iu1b_: 1iu1 B: [71429]

Details for d1iu1b_

PDB Entry: 1iu1, 1.8 Å

PDB Description: crystal structure of human gamma1-adaptin ear domain

PDB Compounds: (B:) gamma1-adaptin

SCOP Domain Sequences for d1iu1b_:

Sequence; same for both SEQRES and ATOM records:

>d1iu1b_ b.1.10.2 (B:) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
iaagipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfq
lqllspsssivpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppq
swq

Timeline for d1iu1b_:

• d1iu1b_ first appeared in SCOP 1.61
  
• d1iu1b_ appears in SCOP 1.71
  
• d1iu1b_ appears in SCOP 1.75
  
• d1iu1b_ appears in the current release, SCOPe 2.08