Lineage for d1itya_ (1ity A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210247Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 210423Family a.4.1.4: DNA-binding domain of human telomeric protein, hTRF1 [46745] (1 protein)
  6. 210424Protein DNA-binding domain of human telomeric protein, hTRF1 [46746] (1 species)
  7. 210425Species Human (Homo sapiens) [TaxId:9606] [46747] (3 PDB entries)
  8. 210427Domain d1itya_: 1ity A: [71427]

Details for d1itya_

PDB Entry: 1ity (more details)

PDB Description: Solution structure of the DNA binding domain of human TRF1

SCOP Domain Sequences for d1itya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itya_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens)}
ekhrarkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklkl
issdsed

SCOP Domain Coordinates for d1itya_:

Click to download the PDB-style file with coordinates for d1itya_.
(The format of our PDB-style files is described here.)

Timeline for d1itya_: