Lineage for d1itxa2 (1itx A:338-409)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) 
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) Protein Chitinase A1 [75390] (1 species) Species Bacillus circulans [TaxId:1397] [75391] (1 PDB entry) 
Domain d1itxa2: 1itx A:338-409 [71426]
Other proteins in same PDB: d1itxa1
complexed with gol
Details for d1itxa2
PDB Entry: 1itx (more details), 1.1 Å
PDB Description: Catalytic Domain of Chitinase A1 from Bacillus circulans WL-12
PDB Compounds: (A:) glycosyl hydrolaseSCOPe Domain Sequences for d1itxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]}
ygrgwdgcaqagngqyqtctggssvgtweagsfdfydleanyinkngytrywndtakvpy
lynasnkrfisy
SCOPe Domain Coordinates for d1itxa2:
Click to download the PDB-style file with coordinates for d1itxa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1itxa2:
- d1itxa2 first appeared in SCOP 1.61
- d1itxa2 appears in SCOPe 2.07
View in 3D
