Lineage for d1itxa1 (1itx A:33-337,A:410-451)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570170Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1570226Protein Chitinase A1 [75069] (1 species)
  7. 1570227Species Bacillus circulans [TaxId:1397] [75070] (1 PDB entry)
  8. 1570228Domain d1itxa1: 1itx A:33-337,A:410-451 [71425]
    Other proteins in same PDB: d1itxa2
    complexed with gol

Details for d1itxa1

PDB Entry: 1itx (more details), 1.1 Å

PDB Description: Catalytic Domain of Chitinase A1 from Bacillus circulans WL-12
PDB Compounds: (A:) glycosyl hydrolase

SCOPe Domain Sequences for d1itxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]}
lqpataeaadsykivgyypswaaygrnynvadidptkvthinyafadicwngihgnpdps
gpnpvtwtcqneksqtinvpngtivlgdpwidtgktfagdtwdqpiagninqlnklkqtn
pnlktiisvggwtwsnrfsdvaataatrevfansavdflrkynfdgvdldweypvsggld
gnskrpedkqnytlllskirekldaagavdgkkylltiasgasatyaantelakiaaivd
winimtydfngawqkisahnaplnydpaasaagvpdantfnvaagaqghldagvpaaklv
lgvpfXddaesvgyktayikskglggamfwelsgdrnktlqnklkadl

SCOPe Domain Coordinates for d1itxa1:

Click to download the PDB-style file with coordinates for d1itxa1.
(The format of our PDB-style files is described here.)

Timeline for d1itxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1itxa2