Lineage for d1itxa1 (1itx A:33-337,A:410-451)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173778Family c.1.8.5: Type II chitinase [51534] (9 proteins)
  6. 173789Protein Chitinase A1 [75069] (1 species)
  7. 173790Species Bacillus circulans [TaxId:1397] [75070] (1 PDB entry)
  8. 173791Domain d1itxa1: 1itx A:33-337,A:410-451 [71425]
    Other proteins in same PDB: d1itxa2

Details for d1itxa1

PDB Entry: 1itx (more details), 1.1 Å

PDB Description: Catalytic Domain of Chitinase A1 from Bacillus circulans WL-12
PDB Compounds: (A:)

SCOP Domain Sequences for d1itxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans}
lqpataeaadsykivgyypswaaygrnynvadidptkvthinyafadicwngihgnpdps
gpnpvtwtcqneksqtinvpngtivlgdpwidtgktfagdtwdqpiagninqlnklkqtn
pnlktiisvggwtwsnrfsdvaataatrevfansavdflrkynfdgvdldweypvsggld
gnskrpedkqnytlllskirekldaagavdgkkylltiasgasatyaantelakiaaivd
winimtydfngawqkisahnaplnydpaasaagvpdantfnvaagaqghldagvpaaklv
lgvpfXddaesvgyktayikskglggamfwelsgdrnktlqnklkadl

SCOP Domain Coordinates for d1itxa1:

Click to download the PDB-style file with coordinates for d1itxa1.
(The format of our PDB-style files is described here.)

Timeline for d1itxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1itxa2