Lineage for d1it8b2 (1it8 B:361-582)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 267385Fold e.36: Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75603] (1 superfamily)
    3 domains: (1 and 2) alpha+beta; (3) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 267386Superfamily e.36.1: Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75604] (1 family) (S)
  5. 267387Family e.36.1.1: Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75605] (1 protein)
  6. 267388Protein Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75606] (1 species)
    the N-terminal domain is homologous to (queosine) tRNA-guanine transglycosylase
  7. 267389Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75607] (3 PDB entries)
  8. 267395Domain d1it8b2: 1it8 B:361-582 [71416]
    Other proteins in same PDB: d1it8a1, d1it8b1
    complexed with mg, pq0, zn

Details for d1it8b2

PDB Entry: 1it8 (more details), 2.5 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii complexed with archaeosine precursor, preq0

SCOP Domain Sequences for d1it8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it8b2 e.36.1.1 (B:361-582) Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains {Archaeon Pyrococcus horikoshii}
pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs
eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla
tvraddglltlgiegakrlhrvlpyprmrvvvnkeaepfarkgkdvfakfvifadpgirp
ydevlvvnendellatgqallsgremivfqygravkvrkgve

SCOP Domain Coordinates for d1it8b2:

Click to download the PDB-style file with coordinates for d1it8b2.
(The format of our PDB-style files is described here.)

Timeline for d1it8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it8b1