![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) |
![]() | Fold e.36: Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75603] (1 superfamily) 3 domains: (1 and 2) alpha+beta; (3) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.36.1: Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75604] (1 family) ![]() |
![]() | Family e.36.1.1: Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75605] (1 protein) |
![]() | Protein Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75606] (1 species) the N-terminal domain is homologous to (queosine) tRNA-guanine transglycosylase |
![]() | Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75607] (3 PDB entries) |
![]() | Domain d1it8a2: 1it8 A:361-582 [71414] Other proteins in same PDB: d1it8a1, d1it8b1 |
PDB Entry: 1it8 (more details), 2.5 Å
SCOP Domain Sequences for d1it8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1it8a2 e.36.1.1 (A:361-582) Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains {Archaeon Pyrococcus horikoshii} pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla tvraddglltlgiegakrlhrvlpyprmrvvvnkeaepfarkgkdvfakfvifadpgirp ydevlvvnendellatgqallsgremivfqygravkvrkgve
Timeline for d1it8a2: