Lineage for d1it8a1 (1it8 A:6-360)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840113Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2840114Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 2840115Protein Archaeosine tRNA-guanine transglycosylase, N-terminal domain [75096] (1 species)
  7. 2840116Species Pyrococcus horikoshii [TaxId:53953] [75097] (4 PDB entries)
  8. 2840121Domain d1it8a1: 1it8 A:6-360 [71413]
    Other proteins in same PDB: d1it8a3, d1it8a4, d1it8b3, d1it8b4
    protein/RNA complex; complexed with mg, pq0, zn

Details for d1it8a1

PDB Entry: 1it8 (more details), 2.5 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii complexed with archaeosine precursor, preq0
PDB Compounds: (A:) archaeosine tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1it8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
kmlkfeikardgagrigklevngkkietpaimpvvnpkqmvvepkelekmgfeiiitnsy
iiykdeelrrkalelgihrmldyngiievdsgsfqlmkygsievsnreiiefqhrigvdi
gtfldiptppdapreqavkeleitlsrareaeeikeipmnatiqgstytdlrryaarrls
smnfeihpiggvvpllesyrfrdvvdivisskmalrpdrpvhlfgaghpivfalavamgv
dlfdsasyalyakddrymtpegtkrldeldyfpcscpvcskytpqelrempkeertrlla
lhnlwvikeeikrvkqaikegelwrlvderarshpklysaykrllehytfleefe

SCOPe Domain Coordinates for d1it8a1:

Click to download the PDB-style file with coordinates for d1it8a1.
(The format of our PDB-style files is described here.)

Timeline for d1it8a1: