Lineage for d1it7a1 (1it7 A:6-360)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685691Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 685692Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 685693Protein Archaeosine tRNA-guanine transglycosylase, N-terminal domain [75096] (1 species)
  7. 685694Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75097] (4 PDB entries)
  8. 685697Domain d1it7a1: 1it7 A:6-360 [71409]
    Other proteins in same PDB: d1it7a3, d1it7a4, d1it7b3, d1it7b4

Details for d1it7a1

PDB Entry: 1it7 (more details), 2.3 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase complexed with guanine
PDB Compounds: (A:) archaeosine tRNA-guanine transglycosylase

SCOP Domain Sequences for d1it7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it7a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
kmlkfeikardgagrigklevngkkietpaimpvvnpkqmvvepkelekmgfeiiitnsy
iiykdeelrrkalelgihrmldyngiievdsgsfqlmkygsievsnreiiefqhrigvdi
gtfldiptppdapreqavkeleitlsrareaeeikeipmnatiqgstytdlrryaarrls
smnfeihpiggvvpllesyrfrdvvdivisskmalrpdrpvhlfgaghpivfalavamgv
dlfdsasyalyakddrymtpegtkrldeldyfpcscpvcskytpqelrempkeertrlla
lhnlwvikeeikrvkqaikegelwrlvderarshpklysaykrllehytfleefe

SCOP Domain Coordinates for d1it7a1:

Click to download the PDB-style file with coordinates for d1it7a1.
(The format of our PDB-style files is described here.)

Timeline for d1it7a1: