Lineage for d1issa_ (1iss A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186118Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 186119Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 186120Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)
  6. 186201Protein Metabotropic glutamate receptor subtype 1 [53847] (1 species)
  7. 186202Species Rat (Rattus norvegicus) [TaxId:10116] [53848] (5 PDB entries)
  8. 186207Domain d1issa_: 1iss A: [71404]

Details for d1issa_

PDB Entry: 1iss (more details), 3.3 Å

PDB Description: Crystal Structure of Metabotropic Glutamate Receptor Subtype 1 Complexed with an antagonist

SCOP Domain Sequences for d1issa_:

Sequence, based on SEQRES records: (download)

>d1issa_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus)}
rsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpvl
lpnitlgseirdscwhssvaleqsiefirdslisirdekdglnrclpdgqtlppgrtkkp
iagvigpgsssvaiqvqnllqlfdipqiaysatsidlsdktlykyflrvvpsdtlqaram
ldivkrynwtyvsavhtegnygesgmdafkelaaqeglciahsdkiysnageksfdrllr
klrerlpkarvvvcfcegmtvrgllsamrrlgvvgefsligsdgwadrdeviegyevean
ggitiklqspevrsfddyflklrldtntrnpwfpefwqhrfqcrlpghllenpnfkkvct
gnesleenyvqdskmgfvinaiyamahglqnmhhalcpghvglcdamkpidgrklldfli
kssfvgvsgeevwfdekgdapgrydimnlqyteanrydyvhvgtwhegvlniddyki

Sequence, based on observed residues (ATOM records): (download)

>d1issa_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus)}
rsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpvl
lpnitlgseirdscwhssvaleqsiefirdslikpiagvigpgsssvaiqvqnllqlfdi
pqiaysatsidlsdktlykyflrvvpsdtlqaramldivkrynwtyvsavhtegnygesg
mdafkelaaqeglciahsdkiysnageksfdrllrklrerlpkarvvvcfcegmtvrgll
samrrlgvvgefsligsdgwadrdeviegyeveanggitiklqspevrsfddyflklrld
tntrnpwfpefwqhrfqcrlpghllenpnfkkvctgnesleenyvqdskmgfvinaiyam
ahglqnmhhalcpghvglcdamkpidgrklldflikssfvgvsgeevwfdekgdapgryd
imnlqyteanrydyvhvgtwhegvlniddyki

SCOP Domain Coordinates for d1issa_:

Click to download the PDB-style file with coordinates for d1issa_.
(The format of our PDB-style files is described here.)

Timeline for d1issa_: