Lineage for d1isna2 (1isn A:215-340)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957608Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 957625Protein Merlin [69294] (2 species)
    the neurofibromatosis 2 tumor suppressor protein
  7. 957629Species Mouse (Mus musculus) [TaxId:10090] [74995] (1 PDB entry)
  8. 957630Domain d1isna2: 1isn A:215-340 [71401]
    Other proteins in same PDB: d1isna1, d1isna3

Details for d1isna2

PDB Entry: 1isn (more details), 2.9 Å

PDB Description: Crystal structure of merlin FERM domain
PDB Compounds: (A:) merlin

SCOPe Domain Sequences for d1isna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isna2 b.55.1.5 (A:215-340) Merlin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrrkadslevqqmkaqareekarkqm
erqrla

SCOPe Domain Coordinates for d1isna2:

Click to download the PDB-style file with coordinates for d1isna2.
(The format of our PDB-style files is described here.)

Timeline for d1isna2: