![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
![]() | Protein Merlin [69294] (2 species) the neurofibromatosis 2 tumor suppressor protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [74995] (1 PDB entry) |
![]() | Domain d1isna2: 1isn A:215-340 [71401] Other proteins in same PDB: d1isna1, d1isna3 |
PDB Entry: 1isn (more details), 2.9 Å
SCOPe Domain Sequences for d1isna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1isna2 b.55.1.5 (A:215-340) Merlin {Mouse (Mus musculus) [TaxId: 10090]} emygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik pldkkidvfkfnssklrvnklilqlcignhdlfmrrrkadslevqqmkaqareekarkqm erqrla
Timeline for d1isna2: