Lineage for d1isna1 (1isn A:104-214)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439943Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 439958Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 439959Family a.11.2.1: Second domain of FERM [47032] (6 proteins)
  6. 439969Protein Merlin [68980] (2 species)
    the neurofibromatosis 2 tumor suppressor protein
  7. 439973Species Mouse (Mus musculus) [TaxId:10090] [74702] (1 PDB entry)
  8. 439974Domain d1isna1: 1isn A:104-214 [71400]
    Other proteins in same PDB: d1isna2, d1isna3

Details for d1isna1

PDB Entry: 1isn (more details), 2.9 Å

PDB Description: Crystal structure of merlin FERM domain

SCOP Domain Sequences for d1isna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isna1 a.11.2.1 (A:104-214) Merlin {Mouse (Mus musculus)}
naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

SCOP Domain Coordinates for d1isna1:

Click to download the PDB-style file with coordinates for d1isna1.
(The format of our PDB-style files is described here.)

Timeline for d1isna1: