SCOP 1.67: Domain d1isna1: 1isn A:104-214

Lineage for d1isna1 (1isn A:104-214)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (1 family)

5. Family a.11.2.1: Second domain of FERM [47032] (6 proteins)

6. Protein Merlin [68980] (2 species)
   the neurofibromatosis 2 tumor suppressor protein

7. Species Mouse (Mus musculus) [TaxId:10090] [74702] (1 PDB entry)

8. Domain d1isna1: 1isn A:104-214 [71400]
   Other proteins in same PDB: d1isna2, d1isna3

Details for d1isna1

PDB Entry: 1isn, 2.9 Å

PDB Description: Crystal structure of merlin FERM domain

SCOP Domain Sequences for d1isna1:

Sequence; same for both SEQRES and ATOM records:

>d1isna1 a.11.2.1 (A:104-214) Merlin {Mouse (Mus musculus)}
naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

Timeline for d1isna1:

• d1isna1 first appeared in SCOP 1.61
  
• d1isna1 appears in SCOP 1.65
  
• d1isna1 appears in SCOP 1.69
  
• d1isna1 appears in the current release, SCOPe 2.08