SCOP 1.61: Domain d1isjb_: 1isj B:

Lineage for d1isjb_ (1isj B:)

1. Root: SCOP 1.61

2. Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)

3. Fold e.4: ADP ribosyl cyclase-like [56628] (1 superfamily)

4. Superfamily e.4.1: ADP ribosyl cyclase-like [56629] (1 family)

5. Family e.4.1.1: ADP ribosyl cyclase-like [56630] (2 proteins)

6. Protein Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) [75597] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75598] (6 PDB entries)

8. Domain d1isjb_: 1isj B: [71397]

Details for d1isjb_

PDB Entry: 1isj, 2.3 Å

PDB Description: crystal structure analysis of bst-1/cd157 complexed with nmn

SCOP Domain Sequences for d1isjb_:

Sequence; same for both SEQRES and ATOM records:

>d1isjb_ e.4.1.1 (B:) Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) {Human (Homo sapiens)}
wraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydlf
itlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgld
yqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeipn
lqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcvd
hsthpdcalk

Timeline for d1isjb_:

• d1isjb_ is new in SCOP 1.61
  
• d1isjb_ appears in SCOP 1.63
  
• d1isjb_ appears in the current release, SCOPe 2.08