Lineage for d1ishb_ (1ish B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840000Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 1840044Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 1840153Protein Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) [75597] (1 species)
  7. 1840154Species Human (Homo sapiens) [TaxId:9606] [75598] (6 PDB entries)
  8. 1840160Domain d1ishb_: 1ish B: [71393]
    complexed with enp

Details for d1ishb_

PDB Entry: 1ish (more details), 2.4 Å

PDB Description: crystal structure analysis of bst-1/cd157 complexed with ethenonadp
PDB Compounds: (B:) bone marrow stromal cell antigen 1

SCOPe Domain Sequences for d1ishb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ishb_ c.23.14.3 (B:) Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) {Human (Homo sapiens) [TaxId: 9606]}
wraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydlf
itlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgld
yqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeipn
lqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcvd
hsthpdcalk

SCOPe Domain Coordinates for d1ishb_:

Click to download the PDB-style file with coordinates for d1ishb_.
(The format of our PDB-style files is described here.)

Timeline for d1ishb_: