Lineage for d1ishb_ (1ish B:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200281Fold e.4: ADP ribosyl cyclase-like [56628] (1 superfamily)
  4. 200282Superfamily e.4.1: ADP ribosyl cyclase-like [56629] (1 family) (S)
  5. 200283Family e.4.1.1: ADP ribosyl cyclase-like [56630] (2 proteins)
  6. 200288Protein Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) [75597] (1 species)
  7. 200289Species Human (Homo sapiens) [TaxId:9606] [75598] (6 PDB entries)
  8. 200295Domain d1ishb_: 1ish B: [71393]

Details for d1ishb_

PDB Entry: 1ish (more details), 2.4 Å

PDB Description: crystal structure analysis of bst-1/cd157 complexed with ethenonadp

SCOP Domain Sequences for d1ishb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ishb_ e.4.1.1 (B:) Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) {Human (Homo sapiens)}
wraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydlf
itlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgld
yqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeipn
lqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcvd
hsthpdcalk

SCOP Domain Coordinates for d1ishb_:

Click to download the PDB-style file with coordinates for d1ishb_.
(The format of our PDB-style files is described here.)

Timeline for d1ishb_: