SCOPe 2.05: Domain d1isga_: 1isg A:

Lineage for d1isga_ (1isg A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) [75597] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75598] (6 PDB entries)

8. Domain d1isga_: 1isg A: [71390]
   complexed with ags

Details for d1isga_

PDB Entry: 1isg, 2.6 Å

PDB Description: crystal structure analysis of bst-1/cd157 with atpgammas

PDB Compounds: (A:) bone marrow stromal cell antigen 1

SCOPe Domain Sequences for d1isga_:

Sequence; same for both SEQRES and ATOM records:

>d1isga_ c.23.14.3 (A:) Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) {Human (Homo sapiens) [TaxId: 9606]}
wraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydlf
itlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgld
yqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeipn
lqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcvd
hsthpdcalk

Timeline for d1isga_:

• d1isga_ first appeared in SCOP 1.61
  
• d1isga_ appears in SCOPe 2.04
  
• d1isga_ appears in SCOPe 2.06
  
• d1isga_ appears in the current release, SCOPe 2.08