Lineage for d1is2b3 (1is2 B:1-267)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621090Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2621091Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2621226Family e.6.1.2: acyl-CoA oxidase N-terminal domains [75600] (2 proteins)
  6. 2621231Protein Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 [75601] (1 species)
  7. 2621232Species Norway rat (Rattus norvegicus) [TaxId:10116] [75602] (2 PDB entries)
  8. 2621235Domain d1is2b3: 1is2 B:1-267 [71387]
    Other proteins in same PDB: d1is2a1, d1is2a2, d1is2b1, d1is2b2
    complexed with fad

Details for d1is2b3

PDB Entry: 1is2 (more details), 2.2 Å

PDB Description: crystal structure of peroxisomal acyl-coa oxidase-ii from rat liver
PDB Compounds: (B:) acyl-CoA oxidase

SCOPe Domain Sequences for d1is2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1is2b3 e.6.1.2 (B:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq
erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl
gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl
kmdnyriprenmlmkyaqvkpdgtyvk

SCOPe Domain Coordinates for d1is2b3:

Click to download the PDB-style file with coordinates for d1is2b3.
(The format of our PDB-style files is described here.)

Timeline for d1is2b3: