![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.2: acyl-CoA oxidase N-terminal domains [75600] (2 proteins) |
![]() | Protein Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 [75601] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [75602] (2 PDB entries) |
![]() | Domain d1is2b3: 1is2 B:1-267 [71387] Other proteins in same PDB: d1is2a1, d1is2a2, d1is2b1, d1is2b2 complexed with fad |
PDB Entry: 1is2 (more details), 2.2 Å
SCOPe Domain Sequences for d1is2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1is2b3 e.6.1.2 (B:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl kmdnyriprenmlmkyaqvkpdgtyvk
Timeline for d1is2b3: