SCOP 1.75: Domain d1is2b1: 1is2 B:278-458

Lineage for d1is2b1 (1is2 B:278-458)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins)
   duplication: tandem repeat of this fold

6. Protein Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 [74715] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [74716] (2 PDB entries)

8. Domain d1is2b1: 1is2 B:278-458 [71385]
   Other proteins in same PDB: d1is2a3, d1is2b3

Details for d1is2b1

PDB Entry: 1is2, 2.2 Å

PDB Description: crystal structure of peroxisomal acyl-coa oxidase-ii from rat liver

PDB Compounds: (B:) acyl-CoA oxidase

SCOP Domain Sequences for d1is2b1:

Sequence; same for both SEQRES and ATOM records:

>d1is2b1 a.29.3.2 (B:278-458) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mvfvrsflvgnaaqslskactiairysavrrqseikqsepepqildfqtqqyklfpllat
ayafhfvgrymketylrinesigqgdlselpelhaltaglkafttwtanagieecrmacg
ghgyshssgipniyvtftpactfegentvmmlqtarflmkiydqvrsgklvggmvsylnd
l

Timeline for d1is2b1:

• d1is2b1 first appeared in SCOP 1.61
  
• d1is2b1 appears in SCOP 1.73
  
• d1is2b1 appears in SCOPe 2.01
  
• d1is2b1 appears in the current release, SCOPe 2.08