![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins) duplication: tandem repeat of this fold |
![]() | Protein Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 [74715] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [74716] (2 PDB entries) |
![]() | Domain d1is2b1: 1is2 B:278-458 [71385] Other proteins in same PDB: d1is2a3, d1is2b3 |
PDB Entry: 1is2 (more details), 2.2 Å
SCOP Domain Sequences for d1is2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1is2b1 a.29.3.2 (B:278-458) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} mvfvrsflvgnaaqslskactiairysavrrqseikqsepepqildfqtqqyklfpllat ayafhfvgrymketylrinesigqgdlselpelhaltaglkafttwtanagieecrmacg ghgyshssgipniyvtftpactfegentvmmlqtarflmkiydqvrsgklvggmvsylnd l
Timeline for d1is2b1: