Lineage for d1is2b1 (1is2 B:278-458)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152073Fold a.29: Bromodomain-like [47363] (4 superfamilies)
  4. 152092Superfamily a.29.3: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47203] (2 families) (S)
  5. 152126Family a.29.3.2: Peroxisomal acyl-CoA oxidase-II [74714] (1 protein)
  6. 152127Protein Peroxisomal acyl-CoA oxidase-II [74715] (1 species)
  7. 152128Species Rat (Rattus norvegicus) [TaxId:10116] [74716] (1 PDB entry)
  8. 152131Domain d1is2b1: 1is2 B:278-458 [71385]
    Other proteins in same PDB: d1is2a3, d1is2b3

Details for d1is2b1

PDB Entry: 1is2 (more details), 2.2 Å

PDB Description: crystal structure of peroxisomal acyl-coa oxidase-ii from rat liver

SCOP Domain Sequences for d1is2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1is2b1 a.29.3.2 (B:278-458) Peroxisomal acyl-CoA oxidase-II {Rat (Rattus norvegicus)}
mvfvrsflvgnaaqslskactiairysavrrqseikqsepepqildfqtqqyklfpllat
ayafhfvgrymketylrinesigqgdlselpelhaltaglkafttwtanagieecrmacg
ghgyshssgipniyvtftpactfegentvmmlqtarflmkiydqvrsgklvggmvsylnd
l

SCOP Domain Coordinates for d1is2b1:

Click to download the PDB-style file with coordinates for d1is2b1.
(The format of our PDB-style files is described here.)

Timeline for d1is2b1: