Lineage for d1is2b1 (1is2 B:278-458)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708463Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins)
    duplication: tandem repeat of this fold
  6. 2708470Protein Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 [74715] (1 species)
  7. 2708471Species Norway rat (Rattus norvegicus) [TaxId:10116] [74716] (2 PDB entries)
  8. 2708476Domain d1is2b1: 1is2 B:278-458 [71385]
    Other proteins in same PDB: d1is2a3, d1is2b3
    complexed with fad

Details for d1is2b1

PDB Entry: 1is2 (more details), 2.2 Å

PDB Description: crystal structure of peroxisomal acyl-coa oxidase-ii from rat liver
PDB Compounds: (B:) acyl-CoA oxidase

SCOPe Domain Sequences for d1is2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1is2b1 a.29.3.2 (B:278-458) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mvfvrsflvgnaaqslskactiairysavrrqseikqsepepqildfqtqqyklfpllat
ayafhfvgrymketylrinesigqgdlselpelhaltaglkafttwtanagieecrmacg
ghgyshssgipniyvtftpactfegentvmmlqtarflmkiydqvrsgklvggmvsylnd
l

SCOPe Domain Coordinates for d1is2b1:

Click to download the PDB-style file with coordinates for d1is2b1.
(The format of our PDB-style files is described here.)

Timeline for d1is2b1: