![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins) duplication: tandem repeat of this fold |
![]() | Protein Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 [74715] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [74716] (2 PDB entries) |
![]() | Domain d1is2a1: 1is2 A:272-460 [71382] Other proteins in same PDB: d1is2a3, d1is2b3 complexed with fad |
PDB Entry: 1is2 (more details), 2.2 Å
SCOPe Domain Sequences for d1is2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1is2a1 a.29.3.2 (A:272-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} kltygtmvfvrsflvgnaaqslskactiairysavrrqseikqsepepqildfqtqqykl fpllatayafhfvgrymketylrinesigqgdlselpelhaltaglkafttwtanagiee crmacgghgyshssgipniyvtftpactfegentvmmlqtarflmkiydqvrsgklvggm vsylndlps
Timeline for d1is2a1: