Lineage for d1irxb2 (1irx B:3-319)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105383Protein Class I lysyl-tRNA synthetase [75159] (1 species)
    similar domain organization to GluRS
  7. 2105384Species Pyrococcus horikoshii [TaxId:53953] [75160] (1 PDB entry)
  8. 2105386Domain d1irxb2: 1irx B:3-319 [71381]
    Other proteins in same PDB: d1irxa1, d1irxb1
    complexed with zn

Details for d1irxb2

PDB Entry: 1irx (more details), 2.6 Å

PDB Description: Crystal structure of class I lysyl-tRNA synthetase
PDB Compounds: (B:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d1irxb2:

Sequence, based on SEQRES records: (download)

>d1irxb2 c.26.1.1 (B:3-319) Class I lysyl-tRNA synthetase {Pyrococcus horikoshii [TaxId: 53953]}
hwadyiadkiirergekekyvvesgitpsgyvhvgnfrelftayivghalrdkgyevrhi
hmwddydrfrkvprnvpqewkdylgmpisevpdpwgchesyaehfmrkfeeeveklgiev
dllyaselykrgeyseeirlafekrdkimeilnkyreiakqpplpenwwpamvycpehrr
eaeiiewdggwkvkykcpeghegwvdirsgnvklrwrvdwpmrwshfgvdfepagkdhlv
agssydtgkeiikevygkeaplslmyefvgikgqkgkmsgskgnvillsdlyevlepglv
rfiyarhrpnkeikidl

Sequence, based on observed residues (ATOM records): (download)

>d1irxb2 c.26.1.1 (B:3-319) Class I lysyl-tRNA synthetase {Pyrococcus horikoshii [TaxId: 53953]}
hwadyiadkiirergekekyvvesgitpsgyvhvgnfrelftayivghalrdkgyevrhi
hmwddydrfrkvprnvpqewkdylgmpisevpdpwgchesyaehfmrkfeeeveklgiev
dllyaselykrgeyseeirlafekrdkimeilnkyreiakqpplpenwwpamvycpehrr
eaeiiewdggwkvkykcpeghegwvdirsgnvklrwrvdwpmrwshfgvdfepagkdhlv
agssydtgkeiikevygkeaplslmyefvgikgqnvillsdlyevlepglvrfiyarhrp
nkeikidl

SCOPe Domain Coordinates for d1irxb2:

Click to download the PDB-style file with coordinates for d1irxb2.
(The format of our PDB-style files is described here.)

Timeline for d1irxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1irxb1