Lineage for d1irxa1 (1irx A:320-523)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003435Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2003436Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 2003458Family a.97.1.2: C-terminal domain of class I lysyl-tRNA synthetase [74759] (1 protein)
  6. 2003459Protein C-terminal domain of class I lysyl-tRNA synthetase [74760] (1 species)
  7. 2003460Species Pyrococcus horikoshii [TaxId:53953] [74761] (1 PDB entry)
  8. 2003461Domain d1irxa1: 1irx A:320-523 [71378]
    Other proteins in same PDB: d1irxa2, d1irxb2
    complexed with zn

Details for d1irxa1

PDB Entry: 1irx (more details), 2.6 Å

PDB Description: Crystal structure of class I lysyl-tRNA synthetase
PDB Compounds: (A:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d1irxa1:

Sequence, based on SEQRES records: (download)

>d1irxa1 a.97.1.2 (A:320-523) C-terminal domain of class I lysyl-tRNA synthetase {Pyrococcus horikoshii [TaxId: 53953]}
glgilnlydefekveriyfgveggkgddeelrrtyelsmpkkperlvaqapfrflavlvq
lphlteediinvlikqghiprdlskedvervklrinlarnwvkkyapedvkfsilekppe
vevsedvreamnevaewlenheefsveefnnilfevakrrgissrewfstlyrlfigker
gprlasflasldrsfvikrlrleg

Sequence, based on observed residues (ATOM records): (download)

>d1irxa1 a.97.1.2 (A:320-523) C-terminal domain of class I lysyl-tRNA synthetase {Pyrococcus horikoshii [TaxId: 53953]}
glgilnlydefekveriyfgvegeelrrtyelsmpkkperlvaqapfrflavlvqlphlt
eediinvlikqghiprdlskedvervklrinlarnwvkkyapedvkfsilekppevevse
dvreamnevaewlenheefsveefnnilfevakrrgissrewfstlyrlfigkergprla
sflasldrsfvikrlrleg

SCOPe Domain Coordinates for d1irxa1:

Click to download the PDB-style file with coordinates for d1irxa1.
(The format of our PDB-style files is described here.)

Timeline for d1irxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1irxa2