Lineage for d1irue_ (1iru E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934686Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1935278Species Cow (Bos taurus) [TaxId:9913] [75568] (1 PDB entry)
  8. 1935283Domain d1irue_: 1iru E: [71356]
    Other proteins in same PDB: d1iru1_, d1iru2_, d1iruh_, d1irui_, d1iruj_, d1iruk_, d1irul_, d1irum_, d1irun_, d1iruv_, d1iruw_, d1irux_, d1iruy_, d1iruz_
    different sequences
    complexed with mg

Details for d1irue_

PDB Entry: 1iru (more details), 2.75 Å

PDB Description: Crystal Structure of the mammalian 20S proteasome at 2.75 A resolution
PDB Compounds: (E:) 20S proteasome

SCOPe Domain Sequences for d1irue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]}
ydrgvntfspegrlfqveydieaiklgstaigiqtsegvclavekritsplmepssieki
veidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeed
adpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqelyhk
smtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi

SCOPe Domain Coordinates for d1irue_:

Click to download the PDB-style file with coordinates for d1irue_.
(The format of our PDB-style files is described here.)

Timeline for d1irue_: