Lineage for d1irmc_ (1irm C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156727Fold a.132: Heme oxygenase [48612] (1 superfamily)
  4. 156728Superfamily a.132.1: Heme oxygenase [48613] (2 families) (S)
  5. 156729Family a.132.1.1: Eukaryotic heme oxygenase [48614] (1 protein)
  6. 156730Protein Heme oxygenase-1 (HO-1) [48615] (2 species)
  7. 156734Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (3 PDB entries)
  8. 156740Domain d1irmc_: 1irm C: [71349]

Details for d1irmc_

PDB Entry: 1irm (more details), 2.55 Å

PDB Description: Crystal structure of apo heme oxygenase-1

SCOP Domain Sequences for d1irmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irmc_ a.132.1.1 (C:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus)}
nsefmrnfqkgqvsregfklvmaslyhiytaleeeiernkqnpvyaplyfpeelhrraal
eqdmafwygphwqeaipytpatqhyvkrlhevggthpellvahaytrylgdlsggqvlkk
iaqkamalpssgeglafftfpsidnptkfkqlyrarmntlemtpevkhrvteeaktafll
nielfeelqallteeh

SCOP Domain Coordinates for d1irmc_:

Click to download the PDB-style file with coordinates for d1irmc_.
(The format of our PDB-style files is described here.)

Timeline for d1irmc_: