SCOPe 2.05: Domain d1irma_: 1irm A:

Lineage for d1irma_ (1irm A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
   Uniprot P06762 11-222

8. Domain d1irma_: 1irm A: [71347]

Details for d1irma_

PDB Entry: 1irm, 2.55 Å

PDB Description: Crystal structure of apo heme oxygenase-1

PDB Compounds: (A:) apo heme oxygenase-1

SCOPe Domain Sequences for d1irma_:

Sequence; same for both SEQRES and ATOM records:

>d1irma_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sefmrnfqkgqvsregfklvmaslyhiytaleeeiernkqnpvyaplyfpeelhrraale
qdmafwygphwqeaipytpatqhyvkrlhevggthpellvahaytrylgdlsggqvlkki
aqkamalpssgeglafftfpsidnptkfkqlyrarmntlemtpevkhrvteeaktaflln
ielfeelqallt

Timeline for d1irma_:

• d1irma_ first appeared in SCOP 1.61
  
• d1irma_ appears in SCOPe 2.04
  
• d1irma_ appears in SCOPe 2.06
  
• d1irma_ appears in the current release, SCOPe 2.08