![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins) |
![]() | Protein Heme oxygenase-1 (HO-1) [48615] (3 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (13 PDB entries) |
![]() | Domain d1irma_: 1irm A: [71347] |
PDB Entry: 1irm (more details), 2.55 Å
SCOP Domain Sequences for d1irma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1irma_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus) [TaxId: 10116]} sefmrnfqkgqvsregfklvmaslyhiytaleeeiernkqnpvyaplyfpeelhrraale qdmafwygphwqeaipytpatqhyvkrlhevggthpellvahaytrylgdlsggqvlkki aqkamalpssgeglafftfpsidnptkfkqlyrarmntlemtpevkhrvteeaktaflln ielfeelqallt
Timeline for d1irma_: