Lineage for d1irib_ (1iri B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 185496Fold c.80: SIS domain [53696] (1 superfamily)
  4. 185497Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 185510Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (1 protein)
  6. 185511Protein Phosphoglucose isomerase, PGI [53702] (4 species)
  7. 185517Species Human (Homo sapiens) [TaxId:9606] [64176] (3 PDB entries)
  8. 185524Domain d1irib_: 1iri B: [71344]

Details for d1irib_

PDB Entry: 1iri (more details), 2.4 Å

PDB Description: Crystal structure of human autocrine motility factor complexed with an inhibitor

SCOP Domain Sequences for d1irib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irib_ c.80.1.2 (B:) Phosphoglucose isomerase, PGI {Human (Homo sapiens)}
maaltrdpqfqklqqwyrehrselnlrrlfdankdrfnhfsltlntnhghilvdysknlv
tedvmrmlvdlaksrgveaarermfngekinytegravlhvalrnrsntpilvdgkdvmp
evnkvldkmksfcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr
vwyvsnidgthiaktlaqlnpesslfiiasktfttqetitnaetakewflqaakdpsava
khfvalstnttkvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga
hwmdqhfrttpleknapvllallgiwyincfgcethamlpydqylhrfaayfqqgdmesn
gkyitksgtrvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
hhkillanflaqtealmrgksteearkelqaagkspedlerllphkvfegnrptnsivft
kltpfmlgalvamyehkifvqgiiwdinsfdqwgvelgkqlakkiepeldgsaqvtshda
stnglinfikqqrearv

SCOP Domain Coordinates for d1irib_:

Click to download the PDB-style file with coordinates for d1irib_.
(The format of our PDB-style files is described here.)

Timeline for d1irib_: