Lineage for d1ir6a_ (1ir6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148530Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456
    Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest
  4. 2148531Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) (S)
    constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains
  5. 2148562Family c.107.1.2: Exonuclease RecJ [75323] (1 protein)
  6. 2148563Protein Exonuclease RecJ [75324] (1 species)
  7. 2148564Species Thermus thermophilus [TaxId:274] [75325] (1 PDB entry)
  8. 2148565Domain d1ir6a_: 1ir6 A: [71342]
    complexed with mn

Details for d1ir6a_

PDB Entry: 1ir6 (more details), 2.9 Å

PDB Description: Crystal structure of exonuclease RecJ bound to manganese
PDB Compounds: (A:) exonuclease RecJ

SCOPe Domain Sequences for d1ir6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]}
plallplkglreaaalleealrqgkrirvhgdydadgltgtailvrglaalgadvhpfip
hrleegygvlmervpehleasdlfltvdcgitnhaelrellengvevivtdhhtpgktpp
pglvvhpaltpdlkekptgagvaflllwalherlglpppleyadlaavgtiadvaplwgw
nralvkeglaripasswvglrllaeavgytgkavevafriaprinaasrlgeaekalrll
ltddaaeaqalvgelhrlnarrqtleeamlrkllpqadpeakaivlldpeghpgvmgiva
srileatlrpvflvaqgkgtvrslapisavealrsaedlllrygghkeaagfamdealfp
afkarveayaarfpdpvrevalldl

SCOPe Domain Coordinates for d1ir6a_:

Click to download the PDB-style file with coordinates for d1ir6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ir6a_: