SCOPe 2.08: Domain d1ir6a_: 1ir6 A:

Lineage for d1ir6a_ (1ir6 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 6 strands, order 321456
   Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest

4. Superfamily c.107.1: DHH phosphoesterases [64182] (3 families)
   constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains

5. Family c.107.1.2: Exonuclease RecJ [75323] (1 protein)

6. Protein Exonuclease RecJ [75324] (1 species)

7. Species Thermus thermophilus [TaxId:274] [75325] (1 PDB entry)

8. Domain d1ir6a_: 1ir6 A: [71342]
   complexed with mn

Details for d1ir6a_

PDB Entry: 1ir6, 2.9 Å

PDB Description: Crystal structure of exonuclease RecJ bound to manganese

PDB Compounds: (A:) exonuclease RecJ

SCOPe Domain Sequences for d1ir6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]}
plallplkglreaaalleealrqgkrirvhgdydadgltgtailvrglaalgadvhpfip
hrleegygvlmervpehleasdlfltvdcgitnhaelrellengvevivtdhhtpgktpp
pglvvhpaltpdlkekptgagvaflllwalherlglpppleyadlaavgtiadvaplwgw
nralvkeglaripasswvglrllaeavgytgkavevafriaprinaasrlgeaekalrll
ltddaaeaqalvgelhrlnarrqtleeamlrkllpqadpeakaivlldpeghpgvmgiva
srileatlrpvflvaqgkgtvrslapisavealrsaedlllrygghkeaagfamdealfp
afkarveayaarfpdpvrevalldl

Timeline for d1ir6a_:

• d1ir6a_ first appeared in SCOP 1.61
  
• d1ir6a_ appears in SCOPe 2.07