| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (11 PDB entries) |
| Domain d1ir2s2: 1ir2 S:11-149 [71327] Other proteins in same PDB: d1ir21_, d1ir22_, d1ir23_, d1ir24_, d1ir25_, d1ir26_, d1ir27_, d1ir28_, d1ir2a1, d1ir2b1, d1ir2c1, d1ir2d1, d1ir2e1, d1ir2f1, d1ir2g1, d1ir2h1, d1ir2i_, d1ir2j_, d1ir2k_, d1ir2l_, d1ir2m_, d1ir2n_, d1ir2o_, d1ir2p_, d1ir2s1, d1ir2t1, d1ir2u1, d1ir2v1, d1ir2w1, d1ir2x1, d1ir2y1, d1ir2z1 complexed with cap, gol, mg |
PDB Entry: 1ir2 (more details), 1.84 Å
SCOPe Domain Sequences for d1ir2s2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ir2s2 d.58.9.1 (S:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv
Timeline for d1ir2s2:
View in 3DDomains from other chains: (mouse over for more information) d1ir21_, d1ir22_, d1ir23_, d1ir24_, d1ir25_, d1ir26_, d1ir27_, d1ir28_, d1ir2a1, d1ir2a2, d1ir2b1, d1ir2b2, d1ir2c1, d1ir2c2, d1ir2d1, d1ir2d2, d1ir2e1, d1ir2e2, d1ir2f1, d1ir2f2, d1ir2g1, d1ir2g2, d1ir2h1, d1ir2h2, d1ir2i_, d1ir2j_, d1ir2k_, d1ir2l_, d1ir2m_, d1ir2n_, d1ir2o_, d1ir2p_, d1ir2t1, d1ir2t2, d1ir2u1, d1ir2u2, d1ir2v1, d1ir2v2, d1ir2w1, d1ir2w2, d1ir2x1, d1ir2x2, d1ir2y1, d1ir2y2, d1ir2z1, d1ir2z2 |