Lineage for d1ir2p_ (1ir2 P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957691Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries)
  8. 2957707Domain d1ir2p_: 1ir2 P: [71325]
    Other proteins in same PDB: d1ir2a1, d1ir2a2, d1ir2b1, d1ir2b2, d1ir2c1, d1ir2c2, d1ir2d1, d1ir2d2, d1ir2e1, d1ir2e2, d1ir2f1, d1ir2f2, d1ir2g1, d1ir2g2, d1ir2h1, d1ir2h2, d1ir2s1, d1ir2s2, d1ir2t1, d1ir2t2, d1ir2u1, d1ir2u2, d1ir2v1, d1ir2v2, d1ir2w1, d1ir2w2, d1ir2x1, d1ir2x2, d1ir2y1, d1ir2y2, d1ir2z1, d1ir2z2
    complexed with cap, gol, mg

Details for d1ir2p_

PDB Entry: 1ir2 (more details), 1.84 Å

PDB Description: Crystal Structure of Activated Ribulose-1,5-bisphosphate Carboxylase/oxygenase (Rubisco) from Green alga, Chlamydomonas reinhardtii Complexed with 2-Carboxyarabinitol-1,5-bisphosphate (2-CABP)
PDB Compounds: (P:) Small subunit of Rubisco

SCOPe Domain Sequences for d1ir2p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir2p_ d.73.1.1 (P:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpksardwqpankrsv

SCOPe Domain Coordinates for d1ir2p_:

Click to download the PDB-style file with coordinates for d1ir2p_.
(The format of our PDB-style files is described here.)

Timeline for d1ir2p_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ir21_, d1ir22_, d1ir23_, d1ir24_, d1ir25_, d1ir26_, d1ir27_, d1ir28_, d1ir2a1, d1ir2a2, d1ir2b1, d1ir2b2, d1ir2c1, d1ir2c2, d1ir2d1, d1ir2d2, d1ir2e1, d1ir2e2, d1ir2f1, d1ir2f2, d1ir2g1, d1ir2g2, d1ir2h1, d1ir2h2, d1ir2i_, d1ir2j_, d1ir2k_, d1ir2l_, d1ir2m_, d1ir2n_, d1ir2o_, d1ir2s1, d1ir2s2, d1ir2t1, d1ir2t2, d1ir2u1, d1ir2u2, d1ir2v1, d1ir2v2, d1ir2w1, d1ir2w2, d1ir2x1, d1ir2x2, d1ir2y1, d1ir2y2, d1ir2z1, d1ir2z2