Lineage for d1ir2g2 (1ir2 G:10-149)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1028497Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 1028498Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1028499Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1028523Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (11 PDB entries)
  8. 1028542Domain d1ir2g2: 1ir2 G:10-149 [71315]
    Other proteins in same PDB: d1ir21_, d1ir22_, d1ir23_, d1ir24_, d1ir25_, d1ir26_, d1ir27_, d1ir28_, d1ir2a1, d1ir2b1, d1ir2c1, d1ir2d1, d1ir2e1, d1ir2f1, d1ir2g1, d1ir2h1, d1ir2i_, d1ir2j_, d1ir2k_, d1ir2l_, d1ir2m_, d1ir2n_, d1ir2o_, d1ir2p_, d1ir2s1, d1ir2t1, d1ir2u1, d1ir2v1, d1ir2w1, d1ir2x1, d1ir2y1, d1ir2z1
    complexed with cap, gol, mg

Details for d1ir2g2

PDB Entry: 1ir2 (more details), 1.84 Å

PDB Description: Crystal Structure of Activated Ribulose-1,5-bisphosphate Carboxylase/oxygenase (Rubisco) from Green alga, Chlamydomonas reinhardtii Complexed with 2-Carboxyarabinitol-1,5-bisphosphate (2-CABP)
PDB Compounds: (G:) Large subunit of Rubisco

SCOPe Domain Sequences for d1ir2g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir2g2 d.58.9.1 (G:10-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
lralrledlrippayvktfv

SCOPe Domain Coordinates for d1ir2g2:

Click to download the PDB-style file with coordinates for d1ir2g2.
(The format of our PDB-style files is described here.)

Timeline for d1ir2g2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ir2g1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ir21_, d1ir22_, d1ir23_, d1ir24_, d1ir25_, d1ir26_, d1ir27_, d1ir28_, d1ir2a1, d1ir2a2, d1ir2b1, d1ir2b2, d1ir2c1, d1ir2c2, d1ir2d1, d1ir2d2, d1ir2e1, d1ir2e2, d1ir2f1, d1ir2f2, d1ir2h1, d1ir2h2, d1ir2i_, d1ir2j_, d1ir2k_, d1ir2l_, d1ir2m_, d1ir2n_, d1ir2o_, d1ir2p_, d1ir2s1, d1ir2s2, d1ir2t1, d1ir2t2, d1ir2u1, d1ir2u2, d1ir2v1, d1ir2v2, d1ir2w1, d1ir2w2, d1ir2x1, d1ir2x2, d1ir2y1, d1ir2y2, d1ir2z1, d1ir2z2