Lineage for d1ir1s_ (1ir1 S:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413835Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 413836Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 413837Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 413838Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 413878Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)
  8. 413883Domain d1ir1s_: 1ir1 S: [71290]
    Other proteins in same PDB: d1ir1a1, d1ir1a2, d1ir1b1, d1ir1b2, d1ir1c1, d1ir1c2, d1ir1d1, d1ir1d2

Details for d1ir1s_

PDB Entry: 1ir1 (more details), 1.8 Å

PDB Description: Crystal Structure of Spinach Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase (Rubisco) Complexed with CO2, Mg2+ and 2-Carboxyarabinitol-1,5-Bisphosphate

SCOP Domain Sequences for d1ir1s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir1s_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mkvwptqnmkryetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrqvqcvsfiaykp
agy

SCOP Domain Coordinates for d1ir1s_:

Click to download the PDB-style file with coordinates for d1ir1s_.
(The format of our PDB-style files is described here.)

Timeline for d1ir1s_: