| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries) |
| Domain d1ir1s_: 1ir1 S: [71290] Other proteins in same PDB: d1ir1a1, d1ir1a2, d1ir1b1, d1ir1b2, d1ir1c1, d1ir1c2, d1ir1d1, d1ir1d2 |
PDB Entry: 1ir1 (more details), 1.8 Å
SCOP Domain Sequences for d1ir1s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ir1s_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mkvwptqnmkryetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrqvqcvsfiaykp
agy
Timeline for d1ir1s_: