Lineage for d1ir1c2 (1ir1 C:12-147)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257593Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 257594Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 257595Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 257644Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 257651Domain d1ir1c2: 1ir1 C:12-147 [71287]
    Other proteins in same PDB: d1ir1a1, d1ir1b1, d1ir1c1, d1ir1d1, d1ir1s_, d1ir1t_, d1ir1u_, d1ir1v_

Details for d1ir1c2

PDB Entry: 1ir1 (more details), 1.8 Å

PDB Description: Crystal Structure of Spinach Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase (Rubisco) Complexed with CO2, Mg2+ and 2-Carboxyarabinitol-1,5-Bisphosphate

SCOP Domain Sequences for d1ir1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir1c2 d.58.9.1 (C:12-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripvayvkt

SCOP Domain Coordinates for d1ir1c2:

Click to download the PDB-style file with coordinates for d1ir1c2.
(The format of our PDB-style files is described here.)

Timeline for d1ir1c2: