Lineage for d1ir1b2 (1ir1 B:12-147)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412559Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 412560Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 412561Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 412618Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 412624Domain d1ir1b2: 1ir1 B:12-147 [71285]
    Other proteins in same PDB: d1ir1a1, d1ir1b1, d1ir1c1, d1ir1d1, d1ir1s_, d1ir1t_, d1ir1u_, d1ir1v_

Details for d1ir1b2

PDB Entry: 1ir1 (more details), 1.8 Å

PDB Description: Crystal Structure of Spinach Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase (Rubisco) Complexed with CO2, Mg2+ and 2-Carboxyarabinitol-1,5-Bisphosphate

SCOP Domain Sequences for d1ir1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir1b2 d.58.9.1 (B:12-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripvayvkt

SCOP Domain Coordinates for d1ir1b2:

Click to download the PDB-style file with coordinates for d1ir1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ir1b2: