SCOPe 2.08: Domain d1ir1b2: 1ir1 B:12-147

Lineage for d1ir1b2 (1ir1 B:12-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (11 PDB entries)

8. Domain d1ir1b2: 1ir1 B:12-147 [71285]
   Other proteins in same PDB: d1ir1a1, d1ir1b1, d1ir1c1, d1ir1d1, d1ir1s_, d1ir1t_, d1ir1u_, d1ir1v_
   complexed with cap, mg

Details for d1ir1b2

PDB Entry: 1ir1, 1.8 Å

PDB Description: Crystal Structure of Spinach Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase (Rubisco) Complexed with CO2, Mg2+ and 2-Carboxyarabinitol-1,5-Bisphosphate

PDB Compounds: (B:) Large subunit of Rubisco

SCOPe Domain Sequences for d1ir1b2:

Sequence; same for both SEQRES and ATOM records:

>d1ir1b2 d.58.9.1 (B:12-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripvayvkt

Timeline for d1ir1b2:

• d1ir1b2 first appeared in SCOP 1.61
  
• d1ir1b2 appears in SCOPe 2.07