![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) ![]() |
![]() | Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins) |
![]() | Protein DNA photolyase [52427] (3 species) binds a light-harvesting cofactor |
![]() | Species Thermus thermophilus [TaxId:274] [69460] (5 PDB entries) |
![]() | Domain d1iqua2: 1iqu A:2-171 [71281] Other proteins in same PDB: d1iqua1 complexed with thymine complexed with fad, po4, tdr |
PDB Entry: 1iqu (more details), 2.2 Å
SCOP Domain Sequences for d1iqua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqua2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpg
Timeline for d1iqua2: