Lineage for d1iqua2 (1iqu A:2-171)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 580522Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 580523Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) (S)
  5. 580524Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)
  6. 580532Protein DNA photolyase [52427] (3 species)
    binds a light-harvesting cofactor
  7. 580547Species Thermus thermophilus [TaxId:274] [69460] (2 PDB entries)
  8. 580549Domain d1iqua2: 1iqu A:2-171 [71281]
    Other proteins in same PDB: d1iqua1
    complexed with thymine
    complexed with fad, po4, tdr

Details for d1iqua2

PDB Entry: 1iqu (more details), 2.2 Å

PDB Description: Crystal structure of photolyase-thymine complex

SCOP Domain Sequences for d1iqua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqua2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus}
gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpg

SCOP Domain Coordinates for d1iqua2:

Click to download the PDB-style file with coordinates for d1iqua2.
(The format of our PDB-style files is described here.)

Timeline for d1iqua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iqua1