Lineage for d1iqua2 (1iqu A:2-171)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178711Fold c.28: N-terminal domain of DNA photolyase [52424] (1 superfamily)
  4. 178712Superfamily c.28.1: N-terminal domain of DNA photolyase [52425] (1 family) (S)
  5. 178713Family c.28.1.1: N-terminal domain of DNA photolyase [52426] (1 protein)
  6. 178714Protein N-terminal domain of DNA photolyase [52427] (3 species)
  7. 178720Species Thermus thermophilus [TaxId:274] [69460] (2 PDB entries)
  8. 178722Domain d1iqua2: 1iqu A:2-171 [71281]
    Other proteins in same PDB: d1iqua1

Details for d1iqua2

PDB Entry: 1iqu (more details), 2.2 Å

PDB Description: Crystal structure of photolyase-thymine complex

SCOP Domain Sequences for d1iqua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqua2 c.28.1.1 (A:2-171) N-terminal domain of DNA photolyase {Thermus thermophilus}
gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpg

SCOP Domain Coordinates for d1iqua2:

Click to download the PDB-style file with coordinates for d1iqua2.
(The format of our PDB-style files is described here.)

Timeline for d1iqua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iqua1