SCOPe 2.07: Domain d1iqua1: 1iqu A:172-416

Lineage for d1iqua1 (1iqu A:172-416)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families)
   automatically mapped to Pfam PF03441

5. Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins)

6. Protein C-terminal domain of DNA photolyase [48175] (3 species)
   N-terminal domain is alpha/beta and binds a light-harvesting cofactor

7. Species Thermus thermophilus [TaxId:274] [69083] (5 PDB entries)

8. Domain d1iqua1: 1iqu A:172-416 [71280]
   Other proteins in same PDB: d1iqua2
   complexed with thymine
   protein/DNA complex; complexed with fad, po4, tdr

Details for d1iqua1

PDB Entry: 1iqu, 2.2 Å

PDB Description: Crystal structure of photolyase-thymine complex

PDB Compounds: (A:) photolyase

SCOPe Domain Sequences for d1iqua1:

Sequence; same for both SEQRES and ATOM records:

>d1iqua1 a.99.1.1 (A:172-416) C-terminal domain of DNA photolyase {Thermus thermophilus [TaxId: 274]}
lplpepgeeaalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweae
rrggegarkwvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktg
vplvdaamrelhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgw
qwagglgvdaapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrryl
rlard

Timeline for d1iqua1:

• d1iqua1 first appeared in SCOP 1.61
  
• d1iqua1 appears in SCOPe 2.06
  
• d1iqua1 appears in the current release, SCOPe 2.08