Lineage for d1iqta_ (1iqt A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192276Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 192277Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 192311Protein Nuclear ribonucleoprotein D0 (AUF1) [75439] (1 species)
  7. 192312Species Human (Homo sapiens) [TaxId:9606] [75440] (1 PDB entry)
  8. 192313Domain d1iqta_: 1iqt A: [71279]

Details for d1iqta_

PDB Entry: 1iqt (more details)

PDB Description: solution structure of the c-terminal rna-binding domain of heterogeneous nuclear ribonucleoprotein d0 (auf1)

SCOP Domain Sequences for d1iqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqta_ d.58.7.1 (A:) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens)}
kifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkimek
kyhnvglskceikva

SCOP Domain Coordinates for d1iqta_:

Click to download the PDB-style file with coordinates for d1iqta_.
(The format of our PDB-style files is described here.)

Timeline for d1iqta_: