Lineage for d1iqac_ (1iqa C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779162Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1779343Protein TRANCE/RANKL cytokine [63721] (1 species)
  7. 1779344Species Mouse (Mus musculus) [TaxId:10090] [63722] (5 PDB entries)
  8. 1779350Domain d1iqac_: 1iqa C: [71276]

Details for d1iqac_

PDB Entry: 1iqa (more details), 2.2 Å

PDB Description: crystal structure of the extracellular domain of mouse rank ligand
PDB Compounds: (C:) receptor activator of nuclear factor kappa b ligand

SCOPe Domain Sequences for d1iqac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqac_ b.22.1.1 (C:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

SCOPe Domain Coordinates for d1iqac_:

Click to download the PDB-style file with coordinates for d1iqac_.
(The format of our PDB-style files is described here.)

Timeline for d1iqac_: