SCOPe 2.05: Domain d1iqab_: 1iqa B:

Lineage for d1iqab_ (1iqa B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein TRANCE/RANKL cytokine [63721] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63722] (5 PDB entries)

8. Domain d1iqab_: 1iqa B: [71275]

Details for d1iqab_

PDB Entry: 1iqa, 2.2 Å

PDB Description: crystal structure of the extracellular domain of mouse rank ligand

PDB Compounds: (B:) receptor activator of nuclear factor kappa b ligand

SCOPe Domain Sequences for d1iqab_:

Sequence; same for both SEQRES and ATOM records:

>d1iqab_ b.22.1.1 (B:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

Timeline for d1iqab_:

• d1iqab_ first appeared in SCOP 1.61
  
• d1iqab_ appears in SCOPe 2.04
  
• d1iqab_ appears in SCOPe 2.06
  
• d1iqab_ appears in the current release, SCOPe 2.08