Lineage for d1iqab_ (1iqa B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662724Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 662725Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 662726Family b.22.1.1: TNF-like [49843] (13 proteins)
  6. 662857Protein TRANCE/RANKL cytokine [63721] (1 species)
  7. 662858Species Mouse (Mus musculus) [TaxId:10090] [63722] (3 PDB entries)
  8. 662863Domain d1iqab_: 1iqa B: [71275]

Details for d1iqab_

PDB Entry: 1iqa (more details), 2.2 Å

PDB Description: crystal structure of the extracellular domain of mouse rank ligand
PDB Compounds: (B:) receptor activator of nuclear factor kappa b ligand

SCOP Domain Sequences for d1iqab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqab_ b.22.1.1 (B:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

SCOP Domain Coordinates for d1iqab_:

Click to download the PDB-style file with coordinates for d1iqab_.
(The format of our PDB-style files is described here.)

Timeline for d1iqab_: