Lineage for d1iqaa_ (1iqa A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117451Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1117452Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1117453Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1117634Protein TRANCE/RANKL cytokine [63721] (1 species)
  7. 1117635Species Mouse (Mus musculus) [TaxId:10090] [63722] (5 PDB entries)
  8. 1117639Domain d1iqaa_: 1iqa A: [71274]

Details for d1iqaa_

PDB Entry: 1iqa (more details), 2.2 Å

PDB Description: crystal structure of the extracellular domain of mouse rank ligand
PDB Compounds: (A:) receptor activator of nuclear factor kappa b ligand

SCOPe Domain Sequences for d1iqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqaa_ b.22.1.1 (A:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

SCOPe Domain Coordinates for d1iqaa_:

Click to download the PDB-style file with coordinates for d1iqaa_.
(The format of our PDB-style files is described here.)

Timeline for d1iqaa_: