Lineage for d1iq8b1 (1iq8 B:6-360)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 819122Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 819123Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 819124Protein Archaeosine tRNA-guanine transglycosylase, N-terminal domain [75096] (1 species)
  7. 819125Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75097] (4 PDB entries)
  8. 819127Domain d1iq8b1: 1iq8 B:6-360 [71272]
    Other proteins in same PDB: d1iq8a3, d1iq8a4, d1iq8b3, d1iq8b4
    complexed with mg, zn

Details for d1iq8b1

PDB Entry: 1iq8 (more details), 2.2 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii
PDB Compounds: (B:) archaeosine tRNA-guanine transglycosylase

SCOP Domain Sequences for d1iq8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq8b1 c.1.20.1 (B:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
kmlkfeikardgagrigklevngkkietpaimpvvnpkqmvvepkelekmgfeiiitnsy
iiykdeelrrkalelgihrmldyngiievdsgsfqlmkygsievsnreiiefqhrigvdi
gtfldiptppdapreqavkeleitlsrareaeeikeipmnatiqgstytdlrryaarrls
smnfeihpiggvvpllesyrfrdvvdivisskmalrpdrpvhlfgaghpivfalavamgv
dlfdsasyalyakddrymtpegtkrldeldyfpcscpvcskytpqelrempkeertrlla
lhnlwvikeeikrvkqaikegelwrlvderarshpklysaykrllehytfleefe

SCOP Domain Coordinates for d1iq8b1:

Click to download the PDB-style file with coordinates for d1iq8b1.
(The format of our PDB-style files is described here.)

Timeline for d1iq8b1: